Protein Info for IAI47_09460 in Pantoea sp. MT58

Annotation: peptide ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00496: SBP_bac_5" amino acids 78 to 457 (380 residues), 312.7 bits, see alignment E=1.9e-97

Best Hits

Swiss-Prot: 71% identical to MPPA_ECOLI: Periplasmic murein peptide-binding protein (mppA) from Escherichia coli (strain K12)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 94% identity to pva:Pvag_1447)

MetaCyc: 71% identical to murein tripeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-268 [EC: 7.4.2.6]

Predicted SEED Role

"Periplasmic Murein Peptide-Binding Protein MppA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>IAI47_09460 peptide ABC transporter substrate-binding protein (Pantoea sp. MT58)
MVKTFRITLAAISLSSILTPAIAANLPAGAQLAEQQQIVRHIKDEPASLDPLKAVGLPEI
QVIRDLFEGLTNQDAQGKIVPGVAQSWSSSDNKTWVFTLRNNARWSNGEPVTAQDFVYSW
QRLVDPKNSSGSAGFAGLSGIENAAAITKGEMTPDKLGVTAQSKTQLKVTLDRPVPWFPA
LVANVALFPVPQKVIAQQRDSWTAPGKLVGNGAYQLSERVVNEKIVLTRNPHYWDDAHSV
LTKVTFVPINEESSATKRYRANDIDITESFPKNMYALLKKTLPGEVYTPDQLGTYYYAFN
TQKGPTADVRVRKALSWSIDRNVIADKVLGTGEKPAWHFTPDVTAGFKPLPTFMQQHDQN
ALNAQAKSLLAAAGYGPGKPLKLKLLYNTSESHQKIAIAVASMWKKNLGVDVTLENQEWK
TYIDSRNSGNFDVIRASWVGDYNEPSTFLNLLTSGNSSNIARFNNADYDAVVAKASRETS
EQARNSDYNRAEQILAEQAPIAPIYQYTNGRLIKPWVKGYPITNPEDVAYSRELWIEKH