Protein Info for IAI47_09445 in Pantoea sp. MT58

Annotation: thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF08534: Redoxin" amino acids 20 to 163 (144 residues), 120 bits, see alignment E=7.8e-39 PF00578: AhpC-TSA" amino acids 22 to 146 (125 residues), 57.4 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 77% identical to TPX_YERPE: Thiol peroxidase (tpx) from Yersinia pestis

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 98% identity to pva:Pvag_1450)

MetaCyc: 75% identical to lipid hydroperoxide peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>IAI47_09445 thiol peroxidase (Pantoea sp. MT58)
MSQTVHFQGNAVPVAGQFPQAGDKAKPFTLVAKNLVNVALSEYAGKRKILNIFPSVDTGV
CASSVRKFNQAASELNNAVVLCISADLPFAQSRFCGAENLSNVVTLSTLRGSEFKYEYGV
EIADGALEGLTARAVIVLDENDKVIYSQLVDEITTEPDYDAALAALK