Protein Info for IAI47_09435 in Pantoea sp. MT58

Annotation: GtrA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details PF04138: GtrA" amino acids 7 to 115 (109 residues), 59 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 50% identical to GTRA_ECOLI: Prophage bactoprenol-linked glucose translocase homolog (yfdG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to pva:Pvag_1452)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>IAI47_09435 GtrA family protein (Pantoea sp. MT58)
MLTFFAKYLTVGLVNTLIHWVTFFICLSLGLFQSTANLIAFSLAVTFSFFVNARWTFEQQ
ATAWRYLIYVVFMGAMAFSVGYLADHFGFYPLITLIASSAISLACGFLFSRFIVFKGE