Protein Info for IAI47_09405 in Pantoea sp. MT58

Annotation: envelope stress response membrane protein PspC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details PF04024: PspC" amino acids 5 to 62 (58 residues), 56.1 bits, see alignment E=1.3e-19 TIGR02978: phage shock protein C" amino acids 5 to 115 (111 residues), 123.3 bits, see alignment E=2.6e-40

Best Hits

Swiss-Prot: 55% identical to PSPC_ECO57: Phage shock protein C (pspC) from Escherichia coli O157:H7

KEGG orthology group: K03973, phage shock protein C (inferred from 90% identity to pva:Pvag_1458)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>IAI47_09405 envelope stress response membrane protein PspC (Pantoea sp. MT58)
MMKGRKLWRKPDEGKLMGVCAGLAEYLDIPVRLLRVIVVLSLFFGLFMFTVVAYFVLGFV
LDVKPANVTEDERQPSASELLDQLESALQRDERSVRDVERYVTSETFSVRSRFRQI