Protein Info for IAI47_09400 in Pantoea sp. MT58

Annotation: envelope stress response membrane protein PspB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02976: phage shock protein B
  • amino acids 1 to 74 (74 residues), 115 bits, E=7.5e-38
• PF06667: PspB
  • amino acids 3 to 74 (72 residues), 115 bits, E=6.7e-38

Best Hits

Swiss-Prot: 78% identical to PSPB_ECOL6: Phage shock protein B (pspB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03970, phage shock protein B (inferred from 99% identity to pva:Pvag_1459)

Predicted SEED Role

"Phage shock protein B"

Protein Sequence (75 amino acids)

>IAI47_09400 envelope stress response membrane protein PspB (Pantoea sp. MT58)
MSALFLAIPLTIFVLFVAPIWLWLHYNNKRNGGSELSQSEIQRLQRVTQDAQRMRERIDA
LEAILDAEHPNWRQP