Protein Info for IAI47_09360 in Pantoea sp. MT58

Annotation: peptide ABC transporter ATP-binding protein SapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 178 (150 residues), 119.7 bits, E=7.9e-39

Best Hits

Swiss-Prot: 84% identical to SAPF_ECOL6: Peptide transport system ATP-binding protein SapF (sapF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to pva:Pvag_1470)

MetaCyc: 84% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Protein Sequence (267 amino acids)

>IAI47_09360 peptide ABC transporter ATP-binding protein SapF (Pantoea sp. MT58)
METLLEVRNLSKTFRYRTGLFRRQHVEAVKSVSFTLREKQTLAIIGENGSGKSTLAKMLS
GMVAPTEGEILIDDHPLTFGDYGYRSQRIRMIFQDPSTSLNPRQRISQILEFPLRLNTEL
NAEEREKRIIATLRQVGLLRDHAGYYPHMLAPGQKQRLGLARALILQPKVIVADEALASL
DMTMRSQLVNLMLELQEKHGIAYIYVTQHLGMMKHISDKVLVMHQGEVVERGGTADVLAS
PLHDLTRRLISSHFGEALSAEAWRRER