Protein Info for IAI47_09315 in Pantoea sp. MT58

Annotation: carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 56 (24 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 510 to 530 (21 residues), see Phobius details amino acids 543 to 566 (24 residues), see Phobius details amino acids 573 to 593 (21 residues), see Phobius details amino acids 640 to 663 (24 residues), see Phobius details PF02554: CstA" amino acids 32 to 408 (377 residues), 586.8 bits, see alignment E=1.7e-180 PF13722: CstA_5TM" amino acids 463 to 591 (129 residues), 129.9 bits, see alignment E=6.7e-42

Best Hits

Swiss-Prot: 64% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 99% identity to pva:Pvag_1479)

MetaCyc: 64% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (689 amino acids)

>IAI47_09315 carbon starvation protein A (Pantoea sp. MT58)
MKNVKTSVIWLVVALIGAGAFAMLALSRGEHVNAVWLVIAAVACYSIAYRFYSLFIARNI
FELDDRRMTPAERLSDGLDYVPTNKWVLFGHHFAAIAGAGPLVGPILAAQMGFLPGTIWI
LVGVMLAGAVQDFLILFISTRRDGRSLGEMARQELGAFAGVVTMLGALGVMIIILSALAL
VVVKALANSPWGLFTIAATIPIALFMGVYMRFIRPGKIAEVSLIGFVLMMAAIIYGGDVA
QHPYWGPFFTLKGTSLTWVLVIYGFIASVLPVWLLLAPRDYLSTFLKIGVIVGLAVGIVF
AMPEMKMPAVTKFIDGTGPVFSGAMFPFLFITIACGAISGFHALVSSGTTPKLVERESHI
RFIGYGAMLMESFVAIMALICASVLDPGVYFAMNSPAALIGTTVESASQVINGWGFVVTP
EMLSGIARDVGEGSILSRAGGAPTFAVGMAHIITEIFNSRAMMAFWYHFAILFEALFILT
AVDAGTRACRFMVQDLVGTVVPSMANNRSWLGNMAGTTVAVAGWGFFVYQGVVDPLGGIN
TLWPLFGIGNQMLASMALILGTVVLFKMKKQRYAWVTILPTVWLFITSMTAGWQKIFHEK
PSIGFLAQANKFRKGLDEGVIIAPAKSVADMQTIVFSNQINAALCAFFMLVAVTMLISAF
FVIRRALNSSVPTTRETPVAMRNKEVRHV