Protein Info for IAI47_09185 in Pantoea sp. MT58

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 4 to 186 (183 residues), 182.3 bits, E=4.3e-58
• PF00117: GATase
  • amino acids 5 to 186 (182 residues), 177.1 bits, E=3.1e-56
• PF07722: Peptidase_C26
  • amino acids 67 to 172 (106 residues), 29.5 bits, E=6.5e-11

Best Hits

Swiss-Prot: 82% identical to TRPG_SHIDY: Anthranilate synthase component II (Fragment) (trpG-TRPD) from Shigella dysenteriae

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_1505)

MetaCyc: 44% identical to 4-amino-4-deoxychorismate synthase; anthranilate synthase (subunit II) (Bacillus subtilis subtilis 168)
RXN-22440 [EC: 2.6.1.123]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• 4-aminobenzoate biosynthesis II (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 2.6.1.123 or 4.1.3.27

Protein Sequence (193 amino acids)

>IAI47_09185 glutamine amidotransferase (Pantoea sp. MT58)
MADILLLDNIDSFTYNLVDQLRTFGHNVVIYRNNLPAELLIEQLQRMENPVLMLSPGPGA
PKDAGCMPALLRVLRGRLPIIGICLGHQAIVEAYGGHVGQAGEILHGKASSIVHDGEAMF
NGLSNPLPVARYHSLVGSNTPDELTVNASYNGMVMAVRHEADRVCGFQFHPESILTSQGA
RLLEQTLAWALAK