Protein Info for IAI47_09155 in Pantoea sp. MT58

Annotation: outer membrane protein OmpW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 8 to 211 (204 residues), 52.3 bits, see alignment E=1.2e-17 PF03922: OmpW" amino acids 23 to 211 (189 residues), 237.1 bits, see alignment E=2.4e-74 PF02462: Opacity" amino acids 106 to 179 (74 residues), 24.9 bits, see alignment E=2.9e-09

Best Hits

Swiss-Prot: 68% identical to OMPW_SALTY: Outer membrane protein W (ompW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07275, outer membrane protein (inferred from 96% identity to pva:Pvag_1511)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>IAI47_09155 outer membrane protein OmpW (Pantoea sp. MT58)
MMKLAKCAMLLALALPQLAMAHEAGDFFMRAGSATVRPTEGSDNVLGMGSFSASNDTQLG
LTFTYMATDNIGVELLAATPFRHKVGLGPTGTLATVRQLPPTLMAQYYFFDSKSKVRPYI
GVGINYTTFYDADFNQTGRDAGLTDLSVKDSWGMAGQVGLDYQINRDWMLNASLWYMDID
TEVKFKAGGEQQNINMRIDPWVFFFGAGYRF