Protein Info for IAI47_09145 in Pantoea sp. MT58

Annotation: UPF0259 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details PF06790: UPF0259" amino acids 1 to 242 (242 residues), 290 bits, see alignment E=9.6e-91

Best Hits

Swiss-Prot: 60% identical to Y1554_CROS8: UPF0259 membrane protein ESA_01554 (ESA_01554) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_1513)

Predicted SEED Role

"Membrane protein YciC, linked to IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>IAI47_09145 UPF0259 family protein (Pantoea sp. MT58)
MSITASSLYRDTGNFARHQLSTVLLMSLLAAFVTVMLVHVLTPGADQMAILQQGDDSASS
LFEMVQNMSPEQQQVLLRASAASTFAALMGNTLLLGGMLYLIPMVSSGQRVSALRAIGAS
APLLPKLLLLTFLMTLVAQLGFMVLVVPGILLTILLSLAPVMVASEKMGVFAAMRASMRM
AWKNVKLIAPAILLWLLAKVIVMLFFSSLTVLPLNVSSVIFTAAGNVVSAMLIIYLYRLY
MLLR