Protein Info for IAI47_09140 in Pantoea sp. MT58

Annotation: septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details PF04279: IspA" amino acids 1 to 175 (175 residues), 234.3 bits, see alignment E=5.6e-74 TIGR00997: intracellular septation protein A" amino acids 1 to 177 (177 residues), 226.4 bits, see alignment E=1.4e-71

Best Hits

Swiss-Prot: 78% identical to YCIB_ERWT9: Probable intracellular septation protein A (ETA_15950) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K06190, intracellular septation protein (inferred from 99% identity to pva:Pvag_1514)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>IAI47_09140 septation protein A (Pantoea sp. MT58)
MKQLLDFLPLVVFFIFYKLYDIFVASGALIVATGLALVVSWVLYRKLEKMTIFTFVLVAV
FGTLTLVFHNDEFIKWKVTVIYSLFAAALLYSQWFMEQTLIQRMLGKELQLPDAVWRRLN
VAWALFFLICGLVNIYVAFWLSQAFWVNFKVFGLSGLTLLFTLLSGLYIWRQMPQQEQK