Protein Info for IAI47_09135 in Pantoea sp. MT58

Annotation: acyl-CoA thioester hydrolase YciA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 26 to 98 (73 residues), 73.6 bits, E=6.6e-25

Best Hits

Swiss-Prot: 78% identical to YCIA_SALTY: Acyl-CoA thioester hydrolase YciA (yciA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 99% identity to pva:Pvag_1515)

MetaCyc: 74% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase YciA, involved in membrane biogenesis"

MetaCyc Pathways

• acyl-CoA hydrolysis (1/1 steps found)
• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Protein Sequence (140 amino acids)

>IAI47_09135 acyl-CoA thioester hydrolase YciA (Pantoea sp. MT58)
MGEKHKLPQGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVVTVRVD
GMSFMKPVAVGDVVSCHASCLRTGNSSMTINVEVWIKKVSSEPIGQTYCATEAVFIYVAV
DNEGNSRPLPAGRANQQPAG