Protein Info for IAI47_09035 in Pantoea sp. MT58

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 187 (187 residues), 212.8 bits, E=5e-67
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 420 (420 residues), 468.3 bits, E=1e-144
• PF00984: UDPG_MGDP_dh
  • amino acids 204 to 296 (93 residues), 136.7 bits, E=3.7e-44
• PF03720: UDPG_MGDP_dh_C
  • amino acids 320 to 424 (105 residues), 100.2 bits, E=1.2e-32

Best Hits

Swiss-Prot: 48% identical to UDG_RHIME: UDP-glucose 6-dehydrogenase (rkpK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to pva:Pvag_1536)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (446 amino acids)

>IAI47_09035 UDP-glucose/GDP-mannose dehydrogenase family protein (Pantoea sp. MT58)
MKVTVFGIGYVGLVQAAVLAEVGHDVLCIDVDENKVENLKKGIIPIFEPGLTPLVMSNYE
AGRLKFSTDAELGVNHGVMQFIAVGTPPDEDGSADLKYVTAVARTIAQHMNDHKVVIDKS
TVPVGTADKVRAVMTEALKARDANITFDVVSNPEFLKEGAAVNDCMRPERIVVGTDNDDV
VELLRELYEPFNRNHDRMIMMDIRSAELTKYAANCMLATKISFMNEMSNLAERLGADIEK
VRQGIGSDPRIGYHFIYPGCGYGGSCFPKDVQALIRTAESIGYQPRLLQAVEDVNDNQKN
KLPTFIKRHFGDDLKGKTFALWGLSFKPNTDDMREASSRVLMETLWEAGASVQAFDPEAM
DEAQRIYGHRSDLKLMGTKEAALQGADGLVICTEWQNFRAPDFDIIKNALKEAVIFDGRN
LYDPERISKRGFVYYAIGRGASIQTA