Protein Info for IAI47_08935 in Pantoea sp. MT58

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00248: Aldo_ket_red" amino acids 16 to 271 (256 residues), 195.3 bits, see alignment E=6.1e-62

Best Hits

Swiss-Prot: 65% identical to YEAE_ECOLI: Uncharacterized protein YeaE (yeaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to pva:Pvag_1554)

MetaCyc: 65% identical to methylglyoxal reductase YeaE (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]

Predicted SEED Role

"Putative oxidoreductase YeaE, aldo/keto reductase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>IAI47_08935 aldo/keto reductase (Pantoea sp. MT58)
MRNTINFADFNNLPVIGQGTWYMGENPAQRSAEIAALQAGLECGLQLIDTAEMYADGGAE
EVVGQAMLGRRDKALLVSKVYPWNAGEVDAIEACERSLRRLQTDYLDLYLLHWRGNVPLE
ETLRAMERLQQQGKIRHWGVSNFDTDDMAELWDEPEGSQCTTNQVLYHLASRGIEFDLLP
ACQQREMPIMAYCPLAQAGRLRDSLFTDPVLTQIAQQKGISVAQLLLAWVIRQPGVIAIP
KASSVVHVQENAAALEVVLTDEELQLIDRAWPAPQHKLPLDIV