Protein Info for IAI47_08920 in Pantoea sp. MT58

Annotation: YeaH/YhbH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF04285: DUF444" amino acids 4 to 420 (417 residues), 628.1 bits, see alignment E=4.1e-193

Best Hits

Swiss-Prot: 90% identical to Y1554_ERWT9: UPF0229 protein ETA_15540 (ETA_15540) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K09786, hypothetical protein (inferred from 99% identity to pva:Pvag_1557)

Predicted SEED Role

"UPF0229 protein YeaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>IAI47_08920 YeaH/YhbH family protein (Pantoea sp. MT58)
MAYFIDRRLNGKNKSAVNRQRFLRRYKSQIKQSISEAINKRSVTDVSSGESVSIPIDDIN
EPIFHQGRGGNRHRVHPGNDHFVQNDRVERPQGGGGGGSGQGNASQDGEGQDEFVFQISK
DEYLDLLFEDLALPNLRRNQHRQLNEYKTHRAGFTSNGVPANISVVRSLQNSLARRTAMT
AGKRRMLHELEETLQEIEKTEPAQLLEEERLRKEIAELRARIERVPFIDTFDLRYKNFEK
RPEPSSQAVMFCLMDVSGSMDQATKDMAKRFYILLYLFLSRTYKNVDVVYIRHHTQAKEV
DEQEFFYSQETGGTIVSSALKLMDEVVKERYDPAQWNIYAAQASDGDNWADDSPLCHEIL
AKHILPVVRYYSYIEITRRAHQTLWREYEHLQATFDNFAIEHIREPEDIYPVFRSLFHKQ
ATEA