Protein Info for IAI47_08905 in Pantoea sp. MT58

Annotation: undecaprenyl-phosphate galactose phosphotransferase WbaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details TIGR03022: undecaprenyl-phosphate galactose phosphotransferase WbaP" amino acids 28 to 488 (461 residues), 559.4 bits, see alignment E=8.5e-172 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 30 to 488 (459 residues), 396.4 bits, see alignment E=2.2e-122 PF13727: CoA_binding_3" amino acids 96 to 206 (111 residues), 32.5 bits, see alignment E=9.1e-12 PF02397: Bac_transf" amino acids 292 to 482 (191 residues), 219.3 bits, see alignment E=2.9e-69

Best Hits

Swiss-Prot: 65% identical to AMSG_ERWAM: UDP-galactose-lipid carrier transferase (amsG) from Erwinia amylovora

KEGG orthology group: K00996, undecaprenyl-phosphate galactose phosphotransferase [EC: 2.7.8.6] (inferred from 100% identity to pva:Pvag_1560)

MetaCyc: 62% identical to undecaprenyl-phosphate galactose phosphotransferase (Salmonella enterica enterica serovar Newport)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>IAI47_08905 undecaprenyl-phosphate galactose phosphotransferase WbaP (Pantoea sp. MT58)
MASTLIMNSPSRSWSGTRKNIIVKFALSFSDLIALNLALFLSAATIQGIWGELDTFIPPH
QIEYRFVAQFIMSVMCTGWFWVRLRHYTYRKPFWFELKEIVKTLFVFSLLDLALIAFSKW
DFSRMVWVFSWTYALLLLPLMRALVKRAINKAGQWQKETIIIGSGRNATEAYAALQSEEI
LGYNVQAFISVDDVPAQQSVNGVPVITWKDINWQTIDRDNVQFIVAMEYEQQPMRDRWLK
FLSKMNCRSVSVIPTLRGVPLYGTDMSFIFSHEVMILRVSNNLAKHSSRFMKRAFDIVVA
SMLLLFLGPIFALLCYMVKRDGGNAIYGHERVGQNGKKFKCLKFRSMVTNSKEVLEKLLA
TSEEARIEWDKDFKLKNDPRVTRIGSFLRKTSLDELPQLWNVIRGEMSLVGPRPVIEAEL
ERYAGDVDYYLMAKPGMTGLWQVSGRNDIDYDTRVYFDSWYVKNWALWTDIAILFKTAGV
VLRRDGAY