Protein Info for IAI47_08855 in Pantoea sp. MT58

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF05209: MinC_N" amino acids 6 to 74 (69 residues), 73.1 bits, see alignment E=1.6e-24 TIGR01222: septum site-determining protein MinC" amino acids 6 to 236 (231 residues), 232 bits, see alignment E=3.8e-73 PF03775: MinC_C" amino acids 133 to 233 (101 residues), 107.3 bits, see alignment E=3.6e-35

Best Hits

Swiss-Prot: 72% identical to MINC_ERWT9: Probable septum site-determining protein MinC (minC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 95% identity to pva:Pvag_1571)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>IAI47_08855 septum site-determining protein MinC (Pantoea sp. MT58)
MSQTPIEFKGSSFTLSVVHLHHHDPAVIRKALQDKIDQAPDFLKNAPVVLNVATLSAEVN
WKQLQQAILATGLRIVGVSGCKNDALKRMISRAGLPVLAEGKESRPRAEAPPPVPVPEPL
PVVTETVATKTRIVNTPVRSGQQIYARDADLIITSSVSAGAELVADGNIHIYGMMRGRAL
AGASGDRNCQIFCTNLAAELVSIAGEYWIMDQIPQEFFGKAARLCLQDGALTIQTLN