Protein Info for IAI47_08715 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 414 (392 residues), 166.9 bits, see alignment E=6.3e-53 PF00083: Sugar_tr" amino acids 37 to 196 (160 residues), 36.2 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 74% identical to YEBQ_ECOLI: Uncharacterized transporter YebQ (yebQ) from Escherichia coli (strain K12)

KEGG orthology group: K08169, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 98% identity to pva:Pvag_1602)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>IAI47_08715 MFS transporter (Pantoea sp. MT58)
MTLSPPQDGLPGRQRYMAIATIAIGLTMAVLDGAIANVALPTISRELNASPAQSIWIVNA
YQIAIIVSLLSLSFLGDMLGYRRVYQAGLALFIATSLFCAFSTTLTMLTFARVLQGLGGA
ALMSVNTALIRIIYPQRYLGRGMAINSLVVAVSTAAGPTVAAAILSVASWKWLFLINVPL
GAIALWLALRTLPDNPQKATAQKFDVPSAIMNALFFGLIISALSGFAQGQSHLLVLSEVV
VLLVTGWFFIRRQLNMAVPLLPVDLLRIPIFSLSMGTSVCSFCAQMLAMVSLPFFLQNVL
QRDEVATGLLLTPWPLATMVFAPIAGRLIERVHAGLLGGIGLAMFALGLFLLAWLPANPG
DGDIIWRMMLCGAGFGLFQSPNNHTIVTSAPRNRSGAASGMLGTARLLGQSMGAALVALM
FNLFDERGTHVSLLLAGSFAAVAALVSVSRMTQTRA