Protein Info for IAI47_08700 in Pantoea sp. MT58

Annotation: RNA chaperone ProQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF04352: ProQ" amino acids 8 to 115 (108 residues), 136.9 bits, see alignment E=2.5e-44 PF17516: ProQ_C" amino acids 184 to 233 (50 residues), 85.9 bits, see alignment 9.8e-29

Best Hits

Swiss-Prot: 74% identical to PROQ_ERWT9: RNA chaperone ProQ (proQ) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03607, ProP effector (inferred from 99% identity to pva:Pvag_1605)

Predicted SEED Role

"ProQ: influences osmotic activation of compatible solute ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>IAI47_08700 RNA chaperone ProQ (Pantoea sp. MT58)
MENQPKLNSSKEVITFLAERFPHCFSAEGEARPLKIGIFQDLVERVQGEMGLSKTQLRSA
LRLYTSSWRYLYGIKAGAIRVDLDGNACGVLDEQHVEHARKQLEEAKARVQAQRDQQRAA
RREAGESEEGAAPRRPRKPAARKPAEGDAARKPRPQTTAAPRATASQHRKPAPRPEQEAR
PITDTSTLQPGQSIKVKAGKSAMDATVLEVSKDGVRVQLASGMAMIVRAEHLQF