Protein Info for IAI47_08690 in Pantoea sp. MT58

Annotation: membrane integrity lipid transport subunit YebS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 298 to 326 (29 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 4 to 404 (401 residues), 572.1 bits, see alignment E=3.4e-176 PF04403: PqiA" amino acids 54 to 204 (151 residues), 126.8 bits, see alignment E=3.4e-41 amino acids 250 to 404 (155 residues), 147.9 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 70% identical to YEBS_ECO57: Intermembrane transport protein YebS (yebS) from Escherichia coli O157:H7

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 97% identity to pva:Pvag_1607)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>IAI47_08690 membrane integrity lipid transport subunit YebS (Pantoea sp. MT58)
MKIHAISQTLPHARYQRCPQCDTLFSLPDVKSHQSAYCPRCNAEILSGRDWSMTRLMAMA
ATMMVLMPFAFSLPLVDIRLLGMRINASVLEGVIQMTQQGDVLTASMVAFCTIGAPVTLV
AGICYLGIGHQLGMNLRPVLLMLEKLKEWVMLDIYLIGIAVASIKVQDYASLEIGYGLAA
YIALTVLSVLTMIHLNIEQLWEHFYPQSPGNMARNEMQVCLNCHNTGVADERGRCPRCHT
PLDFRRRHSLQKSWAALIASIVLLIPANLMPISVVYLNGSRREDTIFSGILGLAEGNIPV
AAIVFIASILVPFIKVLVMLTLLLSIHFRCEQGLRTRIRLLRFVTWVGRWSMLDLFVISL
TMSLVNRDQLLAFTMGPAALFFGAAVILTIMSVEWLDSRLLWDAHATGNADYTD