Protein Info for IAI47_08680 in Pantoea sp. MT58

Annotation: 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17125: Methyltr_RsmF_N
  • amino acids 21 to 117 (97 residues), 87.8 bits, E=1.1e-28
• TIGR00446: NOL1/NOP2/sun family putative RNA methylase
  • amino acids 54 to 322 (269 residues), 346.8 bits, E=3.5e-108
• PF01189: Methyltr_RsmB-F
  • amino acids 131 to 321 (191 residues), 160.8 bits, E=6.8e-51
• PF21150: YebU_pre-PUA_dom
  • amino acids 341 to 417 (77 residues), 132.2 bits, E=1e-42
• PF13636: Methyltranf_PUA
  • amino acids 433 to 481 (49 residues), 47.7 bits, 2.7e-16

Best Hits

Swiss-Prot: 72% identical to RSMF_KLEP3: Ribosomal RNA small subunit methyltransferase F (rsmF) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 96% identity to pva:Pvag_1609)

MetaCyc: 69% identical to 16S rRNA m5C1407 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11593 [EC: 2.1.1.178]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.178

Protein Sequence (488 amino acids)

>IAI47_08680 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF (Pantoea sp. MT58)
MIHCRLCLNWNVPVSEASSFFPADFLSLMRQSLPDEGSFAQFIAYSQQPLRRSIRVNTLK
ISVADFLSQTAGYGWQLTPVPWCEEGFWISREDESLPLGSVAEHLSGLFYIQEASSMLPV
TALFDTQPEVSAVMDMAAAPGSKTTQIAARMGNQGVILANEFSSSRVKVLHANISRCGVS
NSALTHFDARVFGPALPEQFDAILLDAPCSGEGVIRKDADALKNWSLASTEAIADTQRDL
LDSAFHALKAGGTLVYSTCTLNQIENQQVIDWLLQRYPDAVEVVPLEGLFSGAEKAATPE
GYLHVFPQMFDSEGFFVARLRKTASVEPLPVPGYKVGKLPFSHLSRKLESEIAQAAAAVS
IRWDDSLELWQRDKEIWLFPKAVTPLLGKVRFSRIGLKLAETFAKGYRWQHEAVIALAQP
DTTQTFELTAAEAEEWYRGRDIYPETAPANNEMIVTYQHQPLGLAKKVGTRIKNSYPREL
VRDGRLFR