Protein Info for IAI47_08665 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 322 (311 residues), 94.6 bits, see alignment E=9.2e-31 amino acids 204 to 384 (181 residues), 70 bits, see alignment E=2.8e-23

Best Hits

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_1612)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>IAI47_08665 MFS transporter (Pantoea sp. MT58)
MGKIFSTFLPLYTTTLLMLLGSGLLTTYVSLRLASEHVNGALIGSIIAANYIGLVIGGKV
GHNLIARVGHIRAYVACAGIITASVVGHGLTDFIPLWVFLRLIIGLCMMCQYMVLESWLN
DQAESSQRGMIFGLYMVATYLGLSGGQVILSLQTGFGVSTLLIVALCFALCLVPIALTTR
THVRPMTPAPMELGYFIRAIPKLLGTTLVTGMAIGAFYGLAPVYGSSKGFTTSQTGYFMS
LTIFAGLVSQFPLSWLSDRYDRQRLLFIIAMLFAVACVPLVVLPHLTFHWMIGIAFAASM
MQFALYPLQVALANDQVAPERRVSLTACLLMAFGIGASIGPLVVGALMEPLGSNMLYLFF
MLCALVIGGLSFVRAPGPLPTTEVPLPHVVMPDSLATSPLGAALIPTLEEEVIHASMGGQ
EPEDERESDEDTRVEENLTDDIPENQQHK