Protein Info for IAI47_08660 in Pantoea sp. MT58

Annotation: choline transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 448 to 470 (23 residues), see Phobius details amino acids 478 to 496 (19 residues), see Phobius details PF02028: BCCT" amino acids 16 to 500 (485 residues), 593.8 bits, see alignment E=1.1e-182 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 54 to 501 (448 residues), 590.4 bits, see alignment E=1.1e-181

Best Hits

Swiss-Prot: 83% identical to BETT_ECOLI: High-affinity choline transport protein (betT) from Escherichia coli (strain K12)

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 88% identity to ctu:CTU_19230)

MetaCyc: 83% identical to choline:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-99

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>IAI47_08660 choline transporter (Pantoea sp. MT58)
MNNPPAGEKDRLNPVVFYTSAGLILTFSLVTILYSELAASWILKTVNWVSATFGWYYMLA
ATLYIVFVLYMACSRFGSIKLGPEHSKPEFSVLSWSAMLFAAGIGIDLMFFSVAEPVTQY
MQPPEGAGQTLEAARQAMVWTLFHYGLTGWSMYALMGIALGYFSYRYNLPLTIRSALYPI
FGKRIYGPIGHTVDIAAVVGTIFGIATTLGIGVVQLNYGLKVLFDIPEGLTAQAALIVLS
VVIATISVTSGVDKGIRFLSELNVIMALGLILFVLFFGNTEFLLNALVLNVGDYINRFMG
MTLNTFAFDRPTQWMNSWTLFFWAWWVAWSPFVGLFLARISRGRTIREFVLGTLIIPFTF
TLLWLSVFGNAALYQIIHGNTEFAQEVMNHAERGFYSLLAQYPAFKLSASIATITGMLFY
VTSADSGSLVLGNFTSRLKDINSDAPNWLRIFWSVAIGVLTLSMLMTNGITALQNTTVIM
GLPFSFVIFFVMAGLFKSLKIEDHRRASATRDTAPYLAHATDRLTWKKRLSRLMNYPGSR
YTQQMMEKTIYPAMQEVAKELELRDGRVTLESVEADEANPIGYLDLRVHLGEEQDFVYQV
WPQQYSIPGFTYRARSGKSTYYRLETFLMEGSQGNDLMDYSKEQVIIDILDQYERHLNFI
HLNREAPGSNISFPSV