Protein Info for IAI47_08505 in Pantoea sp. MT58

Annotation: formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01142: phosphoribosylglycinamide formyltransferase 2
  • amino acids 14 to 391 (378 residues), 620.6 bits, E=4.7e-191
• PF02655: ATP-grasp_3
  • amino acids 121 to 285 (165 residues), 24.2 bits, E=9.4e-09
• PF02222: ATP-grasp
  • amino acids 123 to 294 (172 residues), 185.1 bits, E=2.5e-58
• PF02786: CPSase_L_D2
  • amino acids 134 to 197 (64 residues), 25.7 bits, E=2.4e-09
• PF07478: Dala_Dala_lig_C
  • amino acids 136 to 285 (150 residues), 29.8 bits, E=1.3e-10
• PF21244: PurT_C
  • amino acids 321 to 388 (68 residues), 95.7 bits, E=2.7e-31

Best Hits

Swiss-Prot: 84% identical to PURT_CROS8: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 98% identity to pva:Pvag_1653)

MetaCyc: 81% identical to phosphoribosylglycinamide formyltransferase 2 (Escherichia coli K-12 substr. MG1655)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]; Acetate kinase. [EC: 6.3.1.21, 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• Bifidobacterium shunt (14/15 steps found)
• mixed acid fermentation (14/16 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• pyruvate fermentation to acetate and lactate II (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Propanoate metabolism
• Purine metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2, 2.7.2.1

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 2.7.2.1 or 2.7.2.15 or 6.3.1.21

Protein Sequence (392 amino acids)

>IAI47_08505 formate-dependent phosphoribosylglycinamide formyltransferase (Pantoea sp. MT58)
MTTLGTALRPAATRVMLLGSGELGKEVALECQRLGVEVIAVDRYADAPAMHVAHRSHVIN
MLDGAALAALIAEEQPDFVVPEIEAIATDTLVELEQQGQRVVPTARAARLTMNREGIRRL
AAEELSLPTSRYRFADSKARFDEAAAEIGFPCIVKPVMSSSGKGQSFIRDASQLDKAWDY
AQQGGRAGAGRVIVEGVVNFDFEITLLTISAVDGIHFCAPIGHRQEDGDYRESWQPQQMS
ELALQRAQDVAAEVVKALGGYGLFGVELFVCGDEVVFSEVSPRPHDTGMVTLISQDLSEF
ALHVRAFLGLPVGGIRQYGPSASAVILPQLTSQNVQFVNVEAALGAGLQLRLFGKPEISG
QRRLGVALASGDSTEQAIARAVASAAAVTVQG