Protein Info for IAI47_08480 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 357 (335 residues), 122.3 bits, see alignment E=2.2e-39 PF00083: Sugar_tr" amino acids 54 to 118 (65 residues), 28.2 bits, see alignment E=9.3e-11

Best Hits

Swiss-Prot: 55% identical to MDFA_YERPD: Multidrug transporter MdfA (mdfA) from Yersinia pestis (strain D106004)

KEGG orthology group: K08160, MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein (inferred from 97% identity to pva:Pvag_1658)

MetaCyc: 52% identical to multidrug efflux pump MdfA / Na+:H+ antiporter / K+:H+ antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-101; TRANS-RXN-337; TRANS-RXN-338; TRANS-RXN-42; TRANS-RXN-44

Predicted SEED Role

"Multidrug translocase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>IAI47_08480 MFS transporter (Pantoea sp. MT58)
MPRFQPISQLTGRILLFPLALVLFEFATYIAHDMIQPGMLIVTSEFSVGPEWVSTSLTAY
LIGGVVLQWLLGPLSDKFGRRPVMLSGILFFAVACMLTHWVSSIEEFVSLRFIQGISLCF
IGAVGYAAIQEAFDEALAVRMMALMANVALLAPLAGPLAGAAWLTVGSWRSMFWLFAACS
LVAFVVLWRVMPETAGDRSHSIALPNLARNYGRLMKDRLVVSGSFAIGLVFIPILTWVAL
SPVILMHDEGLSRMQYALLQLPVFLAMIAGNLTLSKLAGRVPIEQPVKFAAWPILIGLSL
ALAASLLNSHSYLLITAGLSLYAFGAGMVNAGLYRLTLYASNEGKGSVAAMLGMISILTL
AVGIELAKSGYFSGGTLWFCLINFISGVLWFGLVILFMRERKRRSRLEAL