Protein Info for IAI47_08455 in Pantoea sp. MT58

Annotation: zinc ABC transporter permease subunit ZnuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 170 to 201 (32 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details PF00950: ABC-3" amino acids 1 to 257 (257 residues), 291.8 bits, see alignment E=5.1e-91 PF01032: FecCD" amino acids 55 to 256 (202 residues), 32.4 bits, see alignment E=5.2e-12

Best Hits

Swiss-Prot: 82% identical to ZNUB_ECOLI: High-affinity zinc uptake system membrane protein ZnuB (znuB) from Escherichia coli (strain K12)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 99% identity to pva:Pvag_1664)

MetaCyc: 82% identical to Zn2+ ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>IAI47_08455 zinc ABC transporter permease subunit ZnuB (Pantoea sp. MT58)
MIELLLPGWIGGVMLALAAGPLGSFVVWRKMSYFGDTLAHASLLGVAFGLLLNVNPYYAV
ILVTVCLALGLVWLERRPHLAIDTLLGIMAHSALSLGLVVVSLMKNVRVDLMAYLFGDLL
AVTPDDLWMMGGGVVIVLLVMAWQWRSLLSMTISPELAQVDGVNIQRTRLVLMLVTALTI
GVAMKFVGALIITSLLIIPAATARRFVRSPEGMAGVAVVIGVIAVTGGLTFSAFYDTPAG
PSVVLCAAILFIFSMVRKPAM