Protein Info for IAI47_08405 in Pantoea sp. MT58

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 321 (315 residues), 533.2 bits, E=5.4e-164
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 7 to 320 (314 residues), 478.5 bits, E=3.5e-148
• PF13489: Methyltransf_23
  • amino acids 119 to 269 (151 residues), 46.4 bits, E=1.1e-15
• PF13847: Methyltransf_31
  • amino acids 122 to 234 (113 residues), 36.9 bits, E=9.1e-13
• PF13649: Methyltransf_25
  • amino acids 125 to 204 (80 residues), 31.6 bits, E=6.5e-11
• PF08242: Methyltransf_12
  • amino acids 126 to 220 (95 residues), 30.1 bits, E=2e-10
• PF08241: Methyltransf_11
  • amino acids 126 to 223 (98 residues), 30.6 bits, E=1.3e-10

Best Hits

Swiss-Prot: 79% identical to CMOB_ERWT9: tRNA U34 carboxymethyltransferase (cmoB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to pva:Pvag_1676)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (322 amino acids)

>IAI47_08405 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Pantoea sp. MT58)
MIDFGRFYQQIAVGPLAKWLEVLPAQISEWQRENLHGHFRDWYKSLEYLPLLEPQKLDLL
HSVTADRDDISDRHRQGIEKLLRNLMPWRKGPYFLYGTHINTEWRSDWKWERVLPHISSL
AGRTVLDVGCGSGYHMWRMIGAGAHLVVGIDPMQLFLVQFEAVRKLLNDDRRAHMLPLGI
EQLPALQAFDTVFSMGVLYHRRSPLDHLLQLKNQLVSGGELVLETLVIEGDLNQVLVPGE
RYAQMRNVFFIPSAEALKSWLEKSGFVDVRIVDFALTTTEEQRRTDWMTSESLAEFLDPD
DPSKTVEGYPAPLRAVLVATKP