Protein Info for IAI47_08385 in Pantoea sp. MT58

Annotation: copper homeostasis protein CutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF03932: CutC" amino acids 3 to 199 (197 residues), 246.8 bits, see alignment E=7.2e-78

Best Hits

Swiss-Prot: 70% identical to CUTC_ERWT9: Copper homeostasis protein CutC (cutC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K06201, copper homeostasis protein (inferred from 97% identity to pva:Pvag_1709)

Predicted SEED Role

"Cytoplasmic copper homeostasis protein cutC" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>IAI47_08385 copper homeostasis protein CutC (Pantoea sp. MT58)
MTTLEICCYGVDCAVTAQQAGADRVELCAAPREGGLTPSAGMLNAARREVSIPVHPIVRP
RGGDFCYTAREFEAMKSDVALIRELGFPGLVIGMLDEDAHIHHGQMRQIMALCDGLSVTF
HRAFDLCHSPKRALEELTDLGVARILTSGQQHSAENGIALLRELNEASTGPIIMAGAGVR
LSNLQKFLDMGIDEVHSSASRLMVSPMRYRKAGVSMCSEAESDEFSRYCVDGDVVEAMKS
VMQMSTVRVA