Protein Info for IAI47_08345 in Pantoea sp. MT58

Annotation: flagellar type III secretion system protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF01312: Bac_export_2" amino acids 6 to 346 (341 residues), 441.6 bits, see alignment E=1e-136 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 6 to 352 (347 residues), 448.8 bits, see alignment E=6.7e-139

Best Hits

Swiss-Prot: 69% identical to FLHB_YEREN: Flagellar biosynthetic protein FlhB (flhB) from Yersinia enterocolitica

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 98% identity to pva:Pvag_1718)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>IAI47_08345 flagellar type III secretion system protein FlhB (Pantoea sp. MT58)
MSDSDEDKTESPTAHRLEKAREEGQIPRSRELTSVLMLLAGIMILWMGGNMMAHRLAAMV
ATGLRFDHGMVRDDKIIVSHIGSLITQALMALLPLMGGLVLVAIAAPMLLGGIVFSGKSI
KFDPKKMNPIAGFKRMFAAQAWTELFKGILKTILVGAVGWWYIWSHWPEMLRLISEAPVT
ALIHGMEMIAVCCSLVMLGLIPMVGYDVFWQLYSHFKKLKMSMQEIRDEHKQQEGDPHVK
GRIRQQMRAAARRRMMADVPKADVIVTNPTHYSVALQYNEKKMSAPKVVAKGAGEIALRI
RELAAEHRIPVLEAPPLARALYRHTEIGQHIPGALYAAVAEVLAWVWQSRRWKREGGLIP
TKPKDLPVPAEMDFAGESKNDG