Protein Info for IAI47_08265 in Pantoea sp. MT58

Annotation: phosphoethanolamine transferase EptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details PF08019: EptA_B_N" amino acids 58 to 206 (149 residues), 139.5 bits, see alignment E=8.3e-45 PF00884: Sulfatase" amino acids 234 to 522 (289 residues), 226.5 bits, see alignment E=5e-71

Best Hits

Swiss-Prot: 70% identical to EPTA_SALTY: Phosphoethanolamine transferase EptA (eptA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 96% identity to pva:Pvag_1734)

MetaCyc: 70% identical to phosphoethanolamine transferase EptA (Escherichia coli K-12 substr. MG1655)
RXN-14379 [EC: 2.7.8.43]

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>IAI47_08265 phosphoethanolamine transferase EptA (Pantoea sp. MT58)
MALTLKRPLISRLTLLILAAVYIAIFLNIAYYRQVLTIMPLNDLHTTLVFLSMPLVAFSV
INIVITLASFIWLDRLLAVLFILLSASAQYFIQTYNIVVDRSMITNMMDTTASESFALIT
PKLLVTLLSSGVLMALLVFWPRIKKQRWRGVLARLLSVLLSAALIVLVALLFYKDYASLF
RNNRELVKALSPSNSIAATLSWYKHEQLQNAPLIRIGEDAHLQPSRSSGKPNLTILVLGE
TSRAQNFSLGGYGRLTNPLLAKDDVIYFPHTTSCGTATAVSVPCMFSNMPRAHYDDVLAA
HQEGLLDVIQRAGISVLWNENDGGCKGACDRVPHQDMTSLNLPGMCIEGECYDDVLFHGL
DEYISQLKGNAVIVLHTIGSHGPTYSHRYPPQFRQFEPTCDTNQIQDCSQQQLINTYDNT
LVNVDHIVDKAINVLRAHQDRFTTSLVYLSDHGESLGENGAYLHGLPYAIAPDTQKHVPL
LIWLSDDYQKRYAVNRGCLNKLAATDEFSQDNLFSTMLGLTGTATHEYVPADDILTSCRS
QP