Protein Info for IAI47_08235 in Pantoea sp. MT58

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00356: LacI" amino acids 3 to 48 (46 residues), 59.9 bits, see alignment 3.4e-20 PF00532: Peripla_BP_1" amino acids 59 to 275 (217 residues), 75.1 bits, see alignment E=1.4e-24 PF13407: Peripla_BP_4" amino acids 67 to 279 (213 residues), 62 bits, see alignment E=1.3e-20 PF13377: Peripla_BP_3" amino acids 172 to 326 (155 residues), 112.8 bits, see alignment E=3.9e-36

Best Hits

Swiss-Prot: 50% identical to ASCG_ECOLI: HTH-type transcriptional regulator AscG (ascG) from Escherichia coli (strain K12)

KEGG orthology group: K03487, LacI family transcriptional regulator, asc operon repressor (inferred from 52% identity to eam:EAMY_0499)

Predicted SEED Role

"AscBF operon repressor" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>IAI47_08235 LacI family DNA-binding transcriptional regulator (Pantoea sp. MT58)
MVTIQDIARVAGVSKATVSRALSGKVFVREEVKARIMQAVADTGYRPNLLARNLSTNKTH
SIGLVITNGLYNGPFFSSLVYQAATLSEKQNRQLVLADGKHSAQDERNAIDLLIELRCEA
IMLYPKYLSVSELDDIVDKIQTPIVVINRELIRNRRHCVFTDHQRSSEEMMAHLLAHGHT
RIAFISGCNDSPTGERRLQGYRNALLNAGIEPDPQLVVQGSWSTESGYDAGLQLLARNIP
FTCVLAANDDMAIGVAKAFQDAGKTIPGDISLAGFDDSVIGKYYTPSLTTVRVPIDEMIQ
DAIKILLHPDESVPSSHQGTLVSRDSVAPQAVAV