Protein Info for IAI47_08220 in Pantoea sp. MT58

Annotation: deferrochelatase/peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01412: Tat-translocated enzyme
  • amino acids 5 to 424 (420 residues), 580.1 bits, E=2.5e-178
• PF04261: Dyp_perox_N
  • amino acids 63 to 215 (153 residues), 156 bits, E=7.1e-50
• TIGR01413: Dyp-type peroxidase family
  • amino acids 63 to 412 (350 residues), 337.2 bits, E=1.1e-104
• PF20628: Dyp_perox_C
  • amino acids 228 to 411 (184 residues), 176.6 bits, E=3.6e-56

Best Hits

Swiss-Prot: 76% identical to EFEB_ECOL5: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 98% identity to pva:Pvag_1742)

MetaCyc: 76% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Protein Sequence (425 amino acids)

>IAI47_08220 deferrochelatase/peroxidase EfeB (Pantoea sp. MT58)
MSRKEDDAQPARRRLLKGLGLLGGAAAIGGGCPFHAAAADSFSPGTVTPQARQQRQPFYG
PHQAGITTPQQASMMLVAFDLLSSDKAELKRLFQLLTQRIAFLTTGGPAPAVTNPQLPPM
DSGILGATIAPDNLTITVSVGHSLFDERFGLAPHKPKKLQPMTRFPNDSLDASQCHGDLL
LQICANTQDTVIHALRDIIKHTPDLLGVRWRREGFISDHAARSQGQETPINLLGFKDGTA
NPDTHNPALMNQLLWVTADQDEPVWARNGSYQAVRLIRFHVEMWDRTPLGEQQTIFGREK
LSGAPLGMQHEHDVPDYARDPDGEVIALDAHIRLANPRTPETASSLMLRRGYSYSAGISA
SGQLEMGLLFVCYQHDLERGFLTVQQRLNGEALEEYIRPFGGGYFFALPGVADASHYLGQ
SLLET