Protein Info for IAI47_08025 in Pantoea sp. MT58

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00207: flagellar motor switch protein FliG" amino acids 2 to 327 (326 residues), 472.2 bits, see alignment E=5.5e-146 PF14842: FliG_N" amino acids 3 to 102 (100 residues), 110.2 bits, see alignment E=1.5e-35 PF14841: FliG_M" amino acids 114 to 185 (72 residues), 82.8 bits, see alignment E=3.4e-27 PF01706: FliG_C" amino acids 216 to 322 (107 residues), 126.2 bits, see alignment E=1.4e-40

Best Hits

Swiss-Prot: 87% identical to FLIG_ECOL6: Flagellar motor switch protein FliG (fliG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 98% identity to pam:PANA_2296)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>IAI47_08025 flagellar motor switch protein FliG (Pantoea sp. MT58)
MSLTGTEKSAILMMTIGEERAAEVFKHLNQREVQHLSGAMANMRQVSHKQLTEVLREFEA
DAEQFAALSLNSNEYLRSVLTRALGEERASSLLEDILETRDTTSGMETLNFMEPQAAADL
IRDEHPQIIATILVHLKRAQAADIVALFDERLRHDVMLRIATFGGVQPAALAELTEVLNG
LLDGTNLKRAKMGGVRTAAEIINLMKTQQEEAVIEAVRDFDGELAQKIIDEMFLFENLVE
VDDRSIQRLLQEVESEQLLVALKGAEQPLREKFLKNMSARAADILRDDLANRGPVRMSAV
ENEQKAILLVVRRLAESGEMVIGGGEETYV