Protein Info for IAI47_07835 in Pantoea sp. MT58

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00532: Peripla_BP_1
  • amino acids 28 to 233 (206 residues), 65.2 bits, E=7e-22
• PF13407: Peripla_BP_4
  • amino acids 29 to 284 (256 residues), 184.9 bits, E=2.2e-58

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 99% identity to pva:Pvag_1835)

Predicted SEED Role

"ABC transport system, periplasmic substrate-binding protein Z5689"

Protein Sequence (312 amino acids)

>IAI47_07835 ABC transporter substrate-binding protein (Pantoea sp. MT58)
MRFNPIVTGLLAATLFSTGLAQAKELKSIGVTVGDLANPFFVQITKGAEMKARQLAGDKV
NVTLVSSGYDLGQQVGQIDNFIAAKVDMIILNAADSKGIAPAVKRARDAGIVVVAVDVAA
DGANATITSDNTQAGAMACKYISDRLKNKGNVVIINGPPVSAVQNRVEGCMNELKTHPDI
KLLSSNQNAKGSREGGLEVMTGLLSANPKIDAVFAINDPTAIGADLAAKQAQRSEFFIVG
VDGSPDGEEALKRKNSLFVATPAQDPQVMAAKAVEIGYDILQGKPAPDKPVLIPVKLIDR
NNIGSYQGWTVK