Protein Info for IAI47_07830 in Pantoea sp. MT58

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 103 to 132 (30 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 257 to 286 (30 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 314 (266 residues), 138.2 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 46% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 99% identity to pva:Pvag_1836)

MetaCyc: 46% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"ABC transport system, permease protein Z5690"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>IAI47_07830 ribose ABC transporter permease (Pantoea sp. MT58)
MTQLARTKAPTLKRALMGDLLQTVGILPILILIVAVFGFVTPNFFTEANLLNITRQASIN
IVLAAGMTFVILTGGIDLSVGSMLGTTAVVALVASLDPMLASLTIPMALGAGLVMGLFNG
ILVAWAGLPPFIVTLGTYTALRGAAYLLANGTTVINSDINFEWIGNGYLGPVPWLIVIAF
AVIAICWFILRRTTLGVHIYAVGGNIQAARLTGIKVGVVLLFVYGMSGLLSGLAGLMSAS
RLYSANGNLGVGYELDAIAAVILGGTSFVGGIGTITGTLIGALIIATLNNGMTLMGVSYF
WQLVIKGAVIIIAVLIDKYRTRHHVS