Protein Info for IAI47_07820 in Pantoea sp. MT58

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 872 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details PF00672: HAMP" amino acids 312 to 361 (50 residues), 37.1 bits, see alignment 8.3e-13 PF12860: PAS_7" amino acids 386 to 431 (46 residues), 32.5 bits, see alignment 2.1e-11 PF00512: HisKA" amino acids 490 to 552 (63 residues), 31.4 bits, see alignment 3.9e-11 PF02518: HATPase_c" amino acids 595 to 709 (115 residues), 84.7 bits, see alignment E=1.5e-27 PF00072: Response_reg" amino acids 740 to 848 (109 residues), 51.2 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_1838)

Predicted SEED Role

"Two-component system sensor protein Z5692"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (872 amino acids)

>IAI47_07820 response regulator (Pantoea sp. MT58)
MQRSYPWQAGARGRLLMFNLLVVSVTLMVSVVAIIGFRHAGAIQEQAQAQTLADMNGSLA
LARDTANVATAAVRLSQVVGALEYQSESQRLQQNQQALQQSLSLLASAPLAARQPERIAR
IRARSLMLEQTINSLLLNGHQRHLQRNNMLSDLWQTQILLSHINQLVQREQLTLPDAALR
EQTERLITIAIRTPTPIAVIEQLQQVMNQWRTVPLTGVTGENVQRLLATQQRLLPLAEAL
EQSDLAIAYATYRIKALVAMLNDDINASVQQVALQSEARTQATHHELDSIIGFIALFVLL
ALAITGYAGIYIYRNLGSSLTAIAGAMTRLAQGEQNVSVPGLQRRDELGELARAFNVFAR
NTASLAHTSRLLKEKSNQLESTFLAMRDGFALFDHNGQLVVWNAQYAELLGLAPREVHRG
VHYQQLLAPLAVDLHDPGEQQEIRLADGRTLELRFSPIPRRGMVNTVLDRTSRKTLEEAL
QHSQKMKAVGQLTGGLAHDFNNLLAVIIGSLALTEGQLMPGPLATRIERARQAADRAAQL
TQRLLAFSRKQALYPRAVSVVTLVDNLQGLLQHSLLPGQQLIIDAQRPGWPAWIDASQLE
NALMNLVVNARDAMHQQNGEIRLRIWNQRRLEGGEKRDRVTIEVIDHGCGMSADVREQVF
EPFFTTKATGSGSGLGLSMVYGFVRQSGGQIELETAPGQGTTVRLLLPRAAEAAVIAPPP
PVPGEADLAADVEAASNRLVLVLDDEPAVRQTLCEHLHQLGYLTLECGDGEEALALLRQT
PDIDLLISDLMLPGEINGAEVIRQAHQNWPQLATLLISGQDLRHQPVTLPLCERLAKPWQ
QAQLVQALQRAWQRSERLNRAQQAATTAPVSH