Protein Info for IAI47_07815 in Pantoea sp. MT58

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 79 to 111 (33 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 202 to 218 (17 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 28 to 279 (252 residues), 259 bits, see alignment E=2.2e-81 PF00528: BPD_transp_1" amino acids 106 to 278 (173 residues), 31.7 bits, see alignment E=6.2e-12

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 96% identity to pva:Pvag_1839)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>IAI47_07815 phosphonate ABC transporter, permease protein PhnE (Pantoea sp. MT58)
MMSHVPDVTLMKQQHRELFAAQPRYLRRIGLMALVVLLYYLFFFSVFGLEWSRLLMGCQQ
LGRYFLRMFVWHDFMNWPFGYYFSQVGITLGIVFAGTLTASLLALPLSFLAARNVMHDGA
AKPLAFLMRRVFDVLRGIDMAIWGLIFVRAVGMGPLAGVLAIILQDVGLLGKLYAEGHEA
VERSPGRGLSAVGANSLQKHRFGIFTQSFPQFLALSLYQIESNTRSAAVLGFVGAGGVGL
VYAENMRLWNWDVVMFLTLILVVVVMVMDVISSRLRKRYISGKPVPLWQPAARG