Protein Info for IAI47_07810 in Pantoea sp. MT58

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 69 (16 residues), see Phobius details amino acids 90 to 117 (28 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 15 to 281 (267 residues), 284.8 bits, see alignment E=3e-89 PF00528: BPD_transp_1" amino acids 111 to 281 (171 residues), 66.9 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 98% identity to pva:Pvag_1840)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>IAI47_07810 phosphonate ABC transporter, permease protein PhnE (Pantoea sp. MT58)
MTEFEHYYQRIRRQQKRDTLLWSLLLVALYLAAGRVAEFNLLTVWQSLPHFFDYLHEILP
VLHLPLLFADGKTEGSLAYWGYRLPIQLPLIWETLQLALASTLVAVAVAAVLAFFAADNT
QTPVSVRMTIRAFVAFLRTMPELAWAVMFVMAFGIGAIPGFLALALHTVGSLTKLFYEAI
ESASDKPVRGLAACGASKLQRMRFAFWPQVKPVFLSYSFMRLEINFRSSTILGLVGAGGI
GQELMTNIKLDRYDQVSITLLLILIVVLLLDTLSGQLRRRVTGDRT