Protein Info for IAI47_07805 in Pantoea sp. MT58

Annotation: phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 6 to 266 (261 residues), 250.1 bits, see alignment E=2.4e-78 TIGR03431: phosphonate ABC transporter, periplasmic phosphonate binding protein" amino acids 7 to 302 (296 residues), 301.4 bits, see alignment E=7e-94 PF12974: Phosphonate-bd" amino acids 31 to 291 (261 residues), 164 bits, see alignment E=2.2e-52

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 97% identity to pva:Pvag_1841)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>IAI47_07805 phosphonate ABC transporter substrate-binding protein (Pantoea sp. MT58)
MKLTSLALLTSVMAFGVSAADAPKQLNLGIMGGQNATQQIGDNQCVKTFLDKELGVDTQM
RNASDYSGVIQGLLGGKIDMVLSMSPASFASVYIQDPKAVDVVGIVVDDKDQSRGYHSVV
IVKADSPYKKLEDLKGKSFGMADPDSTSGFLMPNQAFKKMFGGTVDDKYNNFFSSVTFSG
GHEQDILGVLNNQFDGAVTWTSLVGDYNSGYTSGAFGRLIRMDHPDLMKQIRIIWQSPLI
PNGPVLVSNKLPADFKAKVVSAIKKLDKDDHACFVKAVGGEQHIGEATVADYKNIIDMKR
DLMKGSRG