Protein Info for IAI47_07800 in Pantoea sp. MT58

Annotation: phosphonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 24 to 269 (246 residues), 296 bits, see alignment E=9.7e-93 PF00005: ABC_tran" amino acids 40 to 201 (162 residues), 120.1 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 70% identical to PHNC_YERPA: Phosphonates import ATP-binding protein PhnC (phnC) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 98% identity to pva:Pvag_1842)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>IAI47_07800 phosphonate ABC transporter ATP-binding protein (Pantoea sp. MT58)
MAQALLKTVVDNDLPPASLSGQKVLSVQKLSKAYGDTQVLDQVSFDLHAGELVAVIGRSG
AGKSTLLHMLNGTINATSGAIISLHQGEADRNVVTLNSRQLREWRSQCGMIFQDFCLVPR
LDVLTNVLLGRLSQTSTLKSFFKIFSDQDRAHAIELLQWMNMLPQALQRAENLSGGQMQR
VAICRALMQNPKILLADEPVASLDPKNTKRIMDVLRQVSEQGISVMVNLHSIELVKSYCT
RVIGIQRGVVLFDGHPSRLTDSLLHQLYGDELNQIH