Protein Info for IAI47_07780 in Pantoea sp. MT58

Annotation: phosphonate C-P lyase system protein PhnL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR02324: phosphonate C-P lyase system protein PhnL" amino acids 8 to 225 (218 residues), 349.3 bits, see alignment E=4e-109 PF00005: ABC_tran" amino acids 30 to 184 (155 residues), 109.8 bits, see alignment E=9e-36

Best Hits

Swiss-Prot: 71% identical to PHNL_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL (phnL) from Escherichia coli (strain K12)

KEGG orthology group: K05780, putative phosphonate transport system ATP-binding protein (inferred from 96% identity to pva:Pvag_1846)

MetaCyc: 71% identical to ATP-binding cassette protein PhnL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnL" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>IAI47_07780 phosphonate C-P lyase system protein PhnL (Pantoea sp. MT58)
MTTLTPRLRVENLCKTFVLHNQNGAALPVLHNASLTVGEGECVVLHGHSGSGKSTLLRAL
YGNYQPDSGHIRVAHQGEWIDMAQASARQIIALRRDTLGWVSQFLRVIPRVPTLEIVMQP
LLERGVDREFCEARAAELLSRLNVPQRLWSLAPSTFSGGEQQRVNIARGFIADYPVLLLD
EPTASLDNVNSEAVVSLIEQARARGAAIVGIFHDRAVRERVADRLHLMHPIDTGVQA