Protein Info for IAI47_07745 in Pantoea sp. MT58

Annotation: Brp/Blh family beta-carotene 15,15'-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 44 (17 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 79 to 95 (17 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details TIGR03753: beta-carotene 15,15'-monooxygenase, Brp/Blh family" amino acids 30 to 260 (231 residues), 107.1 bits, see alignment E=6e-35 PF15461: BCD" amino acids 34 to 263 (230 residues), 81.3 bits, see alignment E=4.6e-27

Best Hits

KEGG orthology group: None (inferred from 85% identity to pva:Pvag_1853)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>IAI47_07745 Brp/Blh family beta-carotene 15,15'-dioxygenase (Pantoea sp. MT58)
MTAQVRFGWAGLWGAALAASFSPPAGQVLFATLAIGVIGMAHGASDLDVVKRERQFPFLA
AYGLVILICLFWWHGAPALALPVFLLASALHFALEDAPDGRSPERLARGISMIAAPATLH
LQAFSAILHEAAPGFSMPDALAVGIAITGGLCASGLIFAGFVRQDRRLLTGTLALLLLPP
FVGFSMGFLILHALPQTRQRRDQLKCTSYLRYLQATWPVLTAALLLAAGTIVVMHPVDNA
GIQPLFAVLAALAIPHMLITPWFESRHPA