Protein Info for IAI47_07740 in Pantoea sp. MT58

Annotation: bacteriorhodopsin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details PF01036: Bac_rhodopsin" amino acids 2 to 221 (220 residues), 153.5 bits, see alignment E=3.2e-49

Best Hits

KEGG orthology group: None (inferred from 93% identity to pva:Pvag_1854)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>IAI47_07740 bacteriorhodopsin (Pantoea sp. MT58)
MDQTAFMIGFSVMAIASLIIYVTGDKKYPFGHHTLVHASVPFIAATAYLAMAFGFGNLTL
DSGTIVYLARYADWSITTPLLLAGLVMLAFHEQGKPGEMGGFLTAIIVLDVMMIITGLVS
SLAENPVAKWVWYSWSCAAFLGVVYLLWGPLRALAATRGNALAGAYNKNVALLTLVWFIY
PIVFLVGPEGLSVITDATSVQAFLILDIIAKVFYAFYAAANMKKALSHTTPVGAVRR