Protein Info for IAI47_07610 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 122 to 162 (41 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 271 (176 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to pva:Pvag_1883)

Predicted SEED Role

"Dipeptide transport system permease protein dppC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>IAI47_07610 ABC transporter permease (Pantoea sp. MT58)
MNTLLLPWRFFQSLSWSGRLGLMMSLFWLLMAVFGTSLAPHSIDDIGGGPLMGGLTADNL
LGTDYLGRDMLSRILYGAKFSIGLALSAALLASLIGTLLALLAAVTGRWLEELLGRVNDA
LLVLPGKVLSLMIVAVFGSSLPMLILTAVFTYWPGAFRIAFAMASSLRSMDYVRASRLRG
ESRWYIAIHDILPNMVHPMLTDFGLRFVYIVLLLSGLSFLGLGVQPPYADWGTLVRENMQ
GLFDGSPAVLMPALAIASLTIGANLFIDSLQAMRPMTLAKEGA