Protein Info for IAI47_07605 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 7 to 14 (8 residues), see Phobius details amino acids 32 to 35 (4 residues), see Phobius details transmembrane" amino acids 15 to 31 (17 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 106 (101 residues), 70.2 bits, see alignment E=1.7e-23 PF00528: BPD_transp_1" amino acids 118 to 316 (199 residues), 125.7 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 33% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 98% identity to pva:Pvag_1884)

Predicted SEED Role

"Peptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>IAI47_07605 ABC transporter permease (Pantoea sp. MT58)
MNRYMMFLIARRIGAGILTLLIVSAVVFFITSLLPGDAAQMILGQNATPETVAALRQQLG
LDQPLLMRYIHWLTGMVQGDFGTSFASHLPVSQLVAQRIPATFELAGITTLICVPMALII
GIIAAMNRGSRLDRALVIGTMATVAVPEFLVATVAVLIFAVKLHWVSAMSFGSPDSDLLS
YLKAYALPVLTLCCVLVAQMARMTRAAIINQLDSPYLEMALLKGVSPLRAVLRHALPNAV
GPIANAISLSLSYLFGGVIIIETIFSYPGLASQLVDAVSNRDLPVVQLCVMLFAACYLVL
LLAADILTIAFNPKWRSA