Protein Info for IAI47_07585 in Pantoea sp. MT58

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 24 to 485 (462 residues), 491.9 bits, E=8e-152

Best Hits

Swiss-Prot: 40% identical to BETB_BURVG: NAD/NADP-dependent betaine aldehyde dehydrogenase (betB) from Burkholderia vietnamiensis (strain G4 / LMG 22486)

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_1888)

MetaCyc: 41% identical to 4-guanidinobutyraldehyde dehydrogenase (Pseudomonas putida)
Gamma-guanidinobutyraldehyde dehydrogenase. [EC: 1.2.1.54]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• superpathway of glycol metabolism and degradation (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
• ethylene glycol degradation (2/2 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• phytol degradation (3/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• octane oxidation (2/5 steps found)
• D-arabinose degradation II (1/4 steps found)
• L-arginine degradation IX (arginine:pyruvate transaminase pathway) (1/4 steps found)
• L-arginine degradation VIII (arginine oxidase pathway) (1/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of pentose and pentitol degradation (12/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.54

Protein Sequence (489 amino acids)

>IAI47_07585 aldehyde dehydrogenase (Pantoea sp. MT58)
MLSFDPEKVSLPAGHYIGGQHCQSQGASFEVKRPSDGRVYATLQDATPQDVDRAVTVAHQ
ALKTSGWSGCPPRERGRVLRRWADLIEQDTLLAQLEALGSTRPISDVVLHEIPFTAEAIR
FYAECADKYSGDLFPTRDSSLGMLIAEPYGVIAAITPWNFPLSMASWKCGPALAAGNAVV
LKPSELTPFSTVRMAELAIQAGLPAGVLNIVQGSGAVTGSALVTHPLVRKVSFTGSTVTG
KRIMSDAAQHGMKPVTLELGGKSPQLVFDDAGDLEVLAQRILRGFTANGGQACVAGTRLI
VQRNIADPLVERLAQLCRELKPGVTWQEESRYAPLIDERQGNKVCSVIEAAKAQGAEVLV
GGERFADTDNGWFWQPTLLSHVAQDNPAVQQEIFGPVLTVQTFDDEEQGLAMAAHDTYGL
CAGVHTLSLPRAMRAMRAIEAGTVWINRYGRSGDFIIPTGGFLGSGIGKDLGRQAFQACQ
RQKSVLIDF