Protein Info for IAI47_07565 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 274 to 304 (31 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 330 (270 residues), 144.5 bits, see alignment E=1.8e-46

Best Hits

Swiss-Prot: 38% identical to MGLC_ECOLI: Galactoside transport system permease protein MglC (mglC) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to pva:Pvag_1894)

MetaCyc: 38% identical to D-galactose/methyl-galactoside ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>IAI47_07565 ABC transporter permease (Pantoea sp. MT58)
MKATATPAAPQQPSFFASLRHKLPKDTGIFVVMVGIALIFEMFGWYVRDQSFLLNTNRLI
LIVLQVAIIGIIAVGVTQVIITTGIDLSSGSVIALAAVVAASLAQTSDSLSPMYPSLVNM
PAVIPIAAGIGVGLLAGVVNGVLITRTGIPPFIATLGMMVSARGLAQYYTQGNPISFLSD
GFTSIGQGAMPVVIFLVVALLFHIALKHTRYGKYVYAIGGNMTSAKVSGINVNKYLIIVY
TIAGALSGLAGVVLAARVSSGQSSMGMSYELDAIAAAVIGGSSLMGGVGRITGTLIGAVI
LGLIKSGFTFVGVDAYIQDIIKGIIIVAAVSIDMHRNRKKR