Protein Info for IAI47_07190 in Pantoea sp. MT58

Annotation: ketopantoate reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00745: 2-dehydropantoate 2-reductase
  • amino acids 2 to 293 (292 residues), 203.3 bits, E=2.8e-64
• PF02558: ApbA
  • amino acids 3 to 151 (149 residues), 131.5 bits, E=2e-42
• PF08546: ApbA_C
  • amino acids 177 to 293 (117 residues), 76.4 bits, E=2.5e-25

Best Hits

Swiss-Prot: 35% identical to YKPB_BACSU: Uncharacterized oxidoreductase YkpB (ykpB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 93% identity to pva:Pvag_1932)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (5/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Protein Sequence (304 amino acids)

>IAI47_07190 ketopantoate reductase family protein (Pantoea sp. MT58)
MRILMAGAGATGGYFGARLIQAGQDVTFLVRERRYQQLQTHGLVLQTPQGTEKFQTQLTQ
ASTLKSHYDLIIVTVKSFALEQVMDDIAPAVGPETLIMPILNGMRHIATLQQRFGEDKVI
GGLCKINATLGDKGEVIQMTPLHQLLYGALDGKNDARLQRVDAALRDCQVDTLFSDNIMD
ELWEKWLLLSTLGAVCCLARGNTQQILTSRGGEALLQGIFTEILSVISAEGYQPRPAVTA
RIFELLNNPATPMTSSMYRDLTQGFDIEADQVIGDLLLRAKRNGLATPLLNAVDVNLQVY
LQQR