Protein Info for IAI47_07140 in Pantoea sp. MT58

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF03446: NAD_binding_2" amino acids 5 to 165 (161 residues), 144.4 bits, see alignment E=6.5e-46 PF02737: 3HCDH_N" amino acids 6 to 51 (46 residues), 23.9 bits, see alignment 7.1e-09 PF03807: F420_oxidored" amino acids 6 to 68 (63 residues), 24.2 bits, see alignment E=8.3e-09 PF14833: NAD_binding_11" amino acids 169 to 288 (120 residues), 113 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 80% identical to LTND_PECAS: L-threonate dehydrogenase (ltnD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08319, putative dehydrogenase [EC: 1.1.-.-] (inferred from 96% identity to pva:Pvag_1942)

MetaCyc: 74% identical to L-threonate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18590 [EC: 1.1.1.411]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-

Use Curated BLAST to search for 1.1.-.- or 1.1.1.30 or 1.1.1.411

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>IAI47_07140 NAD(P)-dependent oxidoreductase (Pantoea sp. MT58)
MPAENICVIGLGSMGMGAAKSCLRAGLNTWGVDLNPAALESLRQAGARDAQPSASAFADQ
LDAVLLLVVNAQQVNAILFGEAGLAAKLRPGTAVMVSSTLSAHDAQQIEQRLAEHQLLML
DAPVSGGAAKAASGEMTVMASGSDAAFAYLQPVLDAVAAKVYRVGSEIGLGSTVKIIHQL
LAGVHIAVGAEAMALAARAGIPLDTMYEVVTNAAGNSWMFGDRMKHVVDGDYSPKSAVDI
FVKDLNLVADTAKSLHFPLPLASTALNMFTEASNAGYGREDDSAVIKIFSGITLPQAGEK
N