Protein Info for IAI47_07010 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 116 to 143 (28 residues), see Phobius details amino acids 149 to 178 (30 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 19 to 231 (213 residues), 91.9 bits, see alignment E=2.1e-30

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 57% identity to pnu:Pnuc_0318)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>IAI47_07010 ABC transporter permease (Pantoea sp. MT58)
MLSATKNMFKSFQKNRGLIWQMSKREVMGRYKGSFFGLAWSLFNPLMMLVVYTFVFSVVF
KTRWGSDPNAGKTDFAIVLFIGLIIFNLFSECIGRAPSLITSNVNYVKKVVFPLEVLAFI
NFFAAMFHALVSFFVLLLAILVFKQHIHLTLLLLPIIVLPLMLAILGLSWILSALGVFVR
DIAQTIGIIISVLMFMSPVFYPISALPVTFQKVIMLNPLAFMIEEARKVVFWGVSPDWLM
LVINLVIGGLICVVGYSFFQKVRKGFADVL